PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002419.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 995aa    MW: 109474 Da    PI: 6.2602
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002419.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.4e-29589640152
                   RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              aek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Itr_sc002419.1_g00001.1 589 AEKSISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 640
                              589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.689579660IPR003035RWP-RK domain
PfamPF020423.8E-26593640IPR003035RWP-RK domain
SuperFamilySSF542774.91E-23898986No hitNo description
Gene3DG3DSA:3.10.20.2402.2E-25900981No hitNo description
SMARTSM006664.5E-25900982IPR000270PB1 domain
PROSITE profilePS5174523.719900982IPR000270PB1 domain
PfamPF005644.5E-18901981IPR000270PB1 domain
CDDcd064073.94E-37901981No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 995 aa     Download sequence    Send to blast
MPEPDETALP PRSREFLTPL PQSDRDFLMM DLDREFSWTF DQIFAAAASN PAPPFLFSAS  60
EQPCSPLWVF SDDNDDVAAG NAARLSDYSR LISYAGDLDA ITEGVSGKDE KRRLPPPVLG  120
STAKDYLDIS CKIKEKITQA LRYFKESTGE HVLAQVWAPV KTGGRYVLTT LGQPFVLHPN  180
SNGLHQYRMV SLKYMFSVDG ETDGDLGLPG RVFRQKLPEW TPNVQYYSSK EFPRLSHALD  240
YNVRGTLALP IFEPSGHSCV GVLELIMTSQ KINYAPEVDK VCKALEAVNL RSSEILDHPG  300
MQICNEGRQT ALVEILEILT VVCENYKLPL AQTWVPCRHR SVLADGGGLK KSCSSFDGSC  360
MGQVCMSTTD LAFYVVDARM WYFREACVEH HLQKGQGVAG RAFASQRSCF CEDITQFCKT  420
EYPLVHYARM FGLTSCFAIC LRSTDTGNDD YILEFFLPPR AGNFSDHHTL LSSLLLTMKQ  480
HFRSLRVASG DDIEHELGSI EIIKTKMEEK LDLSPESVSL SKSTFTPQPT KITDAQFCPD  540
TVGDQKLTSG LNATNDGADR REPSDTQNHA SLAGKKDVGK KSVRKRGKAE KSISLEVLQQ  600
YFAGSLKDAA KSLGVCPTTM KRICRQHGIS RWPSRKINKV NRSLSKLKRV IESVHGAEGA  660
FTLTNLATNS IPVAVGSISW PATVNDSNQH TSPCSRPSES PKEKNAFFNH NAPGYQDDTE  720
PSNQILRGQV LGNELAPQQN GFAVGEGSNR SRTGSGSGEE SAGTPTSHFS CQGSPCRGNE  780
PSPPNELILS PIHCPDTKIA SNTESTCQPV RAINLLAANS LPNTLVAEQP QEAFGGMLIE  840
DAGSSHNLRN LCSAGETPFD ERMPECSWTH PPCSDALPKG CLAVRPERVP QYPARPELTS  900
ITIKATYRED IIRFRLPLSS GIIKLTEEVS KRLKLEVGTF DIKYLDDDHE WVLIACDADL  960
QECIDISRSS GSTIIRLLVH DIMPHLGSSC ESSGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016468309.10.0PREDICTED: protein NLP6-like
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLM1AWK00.0M1AWK0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000319450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52232239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7